Query (optional)   in Class  

GrainGenes Sequence Report: L11862_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
L11862_1.cds
Peptide
MGLVKEGADMEEGTLEIGMEYRTVSGVAGPLVILDKVKGPKYQEIVNIRL
GDGTTRRGQVLEVDGEKAVVQVFEGTSGIDNKYTTVQFTGEVLKTPVSLD
MLGRIFNGSGKPIDNGPPILPEAYLDISGSSINPSERTYPEEMIQTGIST
IDVMNSIARGQKIPLFSAAGLPHNEIAAQICRQAGLVKRLEKGKHAEGGG
EDDNFAIVFAAMGVNMETAQFFKRDFEENGSMERVTLFLNLANDPTIERI
ITPRIALTTAEYLAYECGKHVLVILTDMSSYADALREVSAAREEVPGRRG
YPGYMYTDLATIYERAGRIEGRTGSITQIPILTMPNDDITHPTPDLTGYI
TEGQIYIDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRRDHSDVSNQL
YANYAIGKDVQAMKAVVGEEALSSEDLLYLEFLDKFERKFVAQGAYDTRN
IFQSLDLAWTLLRIFPRELLHRIPAKTLDAFYSRDAAH
Structure From Source
L11862
Source Exons
11467
Corresponding Protein
L11862_1.protseq
Gene Product
vacuolar ATPase B subunit
Remark
CDS note: putative
DB_xref: GI:167108
Feature: CDS: function = 'proton pumping ATPase'; standard_name = 'V ATPase B subunit'; protein_id = 'AAA81330.1';
Codon Start
1