Query (optional)   in Class  

GrainGenes Sequence Report: L11872_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
L11872_1.cds
Peptide
MALSVEKTSSGREYKVKDLFQADFGRLELELAEVEMPGLMACRTEFGPSQ
PFKGARISGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSSQDHAAAAIA
RDSAAVFAWKGETLEEYWWCTERCLDWGVGGGPDLIVDDGGDATLLIHEG
VKAEEEFEKSGKVPDPESTDNPEFKIVLTIIRDGLKTDASKYRKMKERLV
GVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPD
GLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQ
ALMEGIQILTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGH
FDNEIDMNGLETYPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGC
ATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVAAL
HLGKLGARLTKLTKSQSDYISIPIEGPYKLRLYRY
Structure From Source
L11872
Source Exons
11458
Corresponding Protein
L11872_1.protseq
Gene Product
S-adenosyl-L-homocysteine hydrolase
Remark
DB_xref: GI:170773
Feature: CDS: protein_id = 'AAA34303.1';
Gene: SH6.2
Codon Start
1