Query (optional)   in Class  

GrainGenes Sequence Report: L11879_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
L11879_1.cds
Peptide
MSCNCGSGCSCGSDCKCGKMYPDLTEQGSAAAQVAAVVVLGVAPENKAGQ
FEVAAGQSGEGCSCGDNCKCNPCNC
Structure From Source
L11879
Source Exons
1228
Corresponding Protein
L11879_1.protseq
Gene Product
metallothionein-like protein
Remark
DB_xref: GI:170787
Feature: CDS: protein_id = 'AAA50846.1';
Gene: wali1
Codon Start
1