Query (optional)   in Class  

GrainGenes Sequence Report: L11881_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
L11881_1.cds
Peptide
MKSSTLLVILILQAVLVMGILSQANAEFPKCCDNCRFFSGAVVCDDAGPK
CRDGCVNCRVVQTSPKKTFRCADARADDGTPCKPCKKH
Structure From Source
L11881
Source Exons
1267
Corresponding Protein
L11881_1.protseq
Remark
DB_xref: GI:170791
Feature: CDS: function = ''unknown''; protein_id = 'AAA50848.1';
Gene: wali3
Codon Start
1