Query (optional)   in Class  

GrainGenes Sequence Report: L11882_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
L11882_1.cds
Peptide
MKGTKLAAILILQAVLVMGLLSHVNADFFPKCCNNCRSFSGVDVCDDAHP
KCPQGCSACRVVSTSPEMWRCADMKSTVDGTCGGPCKKY
Structure From Source
L11882
Source Exons
1270
Corresponding Protein
L11882_1.protseq
Remark
DB_xref: GI:170795
Feature: CDS: function = ''unknown''; protein_id = 'AAA50850.1';
Gene: wali5
Codon Start
1