Query (optional)   in Class  

GrainGenes Sequence Report: L11883_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
L11883_1.cds
Peptide
LMQKMRAVLVEHALANGEAERDVETSVFAKLAMFEQELRAVLPNEVEAAR
SAVENGTATQQNRIADCRSYPLYRFVRKELGTEYLTGEKTRSPGEEVDKV
FVAMNQGKHIDALLECLKEWNGEPLPIC
Structure From Source
L11883
Source Exons
1389
Corresponding Protein
L11883_1.protseq
Gene Product
phenylalanine ammonia-lyase
Remark
DB_xref: GI:170793
Feature: CDS: protein_id = 'AAA50849.1';
Gene: wali4
Codon Start
3