Query (optional)   in Class  

GrainGenes Sequence Report: L13437_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
L13437_1.cds
Peptide
MASSSVLLGASATAALTGTPAGKALPRPCFLAARPRTVSGGRLCLQNAPR
ATPAYNDAADATDKAIDGVKGVADELKKGVAEAAEAVSGNTEKAAEEAGK
GASEVDAKAKDFGEQAKKATEEAWDGAKDAAQGITDKVAAAAKKEAS
Structure From Source
L13437
Source Exons
1444
Corresponding Protein
L13437_1.protseq
Gene Product
cold acclimation protein WCS19
Remark
DB_xref: GI:19352333
Feature: CDS: function = 'associated with the development of leaf freezing tolerance'; protein_id = 'AAA16282.2';
Codon Start
1