Query (optional)   in Class  

GrainGenes Sequence Report: L14444_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
L14444_1.cds
Peptide
DTFRSIVPAISGGTSETAAFANARVDWKETPEAHVFKADLPGVKKEEVKV
EVEDGNVLVVSGERTKEKEDKNDKWHRVERSSGKFVRRFRLPEDAKVEEV
KAGLENGVLTVTVPKAEVKKPEVKAIEISG
Structure From Source
L14444
Source Exons
1393
Corresponding Protein
L14444_1.protseq
Gene Product
heat shock protein 16.9C
Remark
DB_xref: GI:295501
Feature: CDS: protein_id = 'AAA34294.1';
Gene: hsp16.9C
Codon Start
1