Query (optional)   in Class  

GrainGenes Sequence Report: M10056_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
M10056_1.cds
Peptide
ILNVAVEGALWRLRGTDGKAPSMIGWWPAKAVTFVDNHDTGSTQHMWPFP
SDRVMQGYAYILTHPRTPCIFYDHFFDWGPKEEIDRLVSVRTRHGIHNES
KLQIIEADADLYLAEIDGKVIVKLGPRYDVGNLIPGGFEGAAHGNDYAVW
EKI
Structure From Source
M10056
Source Exons
1462
Corresponding Protein
M10056_1.protseq
Remark
CDS note: alpha-amylase type B, EC 3.2.1.1
DB_xref: GI:166989
Feature: CDS: protein_id = 'AAA32930.1';
Codon Start
1