Query (optional)   in Class  

GrainGenes Sequence Report: M10092_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
M10092_1.cds
Peptide
MKTFPILALLAIVATTATTAVRVPVPQLQLQNPSQQQPQEQVPLVQEQQF
QGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFPQPQLPYPQPQPFRPQQPY
PQPQPQYSQPQQPISQQQQQQQQQQQQQQQILQQILQQQLIPCRDVVLQQ
HNIAHGSSQVLQESTYQLVQQLCCQQLWQIPEQSRCQAIHNVVHAIILHQ
QHHHHQQQQQQQQQQPLSQVSFQQPQQQYPSGQGFFQPSQQNPQAQGSFQ
PQQLPQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN
Structure From Source
M10092
Source Exons
1876
Corresponding Protein
M10092_1.protseq
Remark
CDS note: pre-alpha-/beta-gliadin A-II
DB_xref: GI:170712
Feature: CDS: protein_id = 'AAA34276.1';
Codon Start
1