Query (optional)   in Class  

GrainGenes Sequence Report: M10144_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
M10144_1.cds
Peptide
MAATTMSLSSSSFAGKAVKNLPSSALIGDARVNMRKTAAKAKQVSSSSPW
YGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEV
IHCRWAMLGALGCVFPELLARNGVKFGEAGWFKAGSQIFSDGGLDYLGNP
SLVHAQSLLAIWACQVVLMGAVEGYRIAGGPLGEIVDPLYPGGSFDPLGL
AERPQAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLEDLADHIADP
VNNNAWLIATNFVPGK
Structure From Source
M10144
Source Exons
1801
Corresponding Protein
M10144_1.protseq
Remark
CDS note: chlorophyll a/b-binding protein precursor
DB_xref: GI:170674
Feature: CDS: protein_id = 'AAA34260.1';
Codon Start
1