Query (optional)   in Class  

GrainGenes Sequence Report: M11073_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
M11073_1.cds
Peptide
MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
PGQQQQFPPQQPYPQPQPFPSQQPYLQLQPFPQPQPFPPQLPYPQPQSFP
PQQPYPQQQPQYLQPQQPISQQQAQQQQQQQQQQQQQQQILQQILQQQLI
PCRDVVLQQHNIAHASSQVLQQSTYQLLQQLCCQQLLQIPEQSQCQAIHN
VAHAIIMHQQQQQQQEQKQQLQQQQQQQQQLQQQQQQQQQQPSSQVSFQQ
PQQQYPSSQVSFQPSQLNPQAQGSVQPQQLPQFAEIRNLALQTLPAMCNV
YIPPHCSTTIAPFGISGTN
Structure From Source
M11073
Source Exons
1960
Corresponding Protein
M11073_1.protseq
Remark
CDS note: pre-alpha-/beta-gliadin A-V
DB_xref: GI:170716
Feature: CDS: protein_id = 'AAA34278.1';
Codon Start
1