Query (optional)   in Class  

GrainGenes Sequence Report: M11074_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
M11074_1.cds
Peptide
MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
LGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQLPYSQPQPFRPQQPY
PQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQILQQQLIPCMDV
VLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAI
ILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQL
PQFEEIRNLARK
Structure From Source
M11074
Source Exons
1789
Corresponding Protein
M11074_1.protseq
Remark
CDS note: pre-alpha-/beta-gliadin A-I
DB_xref: GI:170722
Feature: CDS: protein_id = 'AAA34281.1';
Codon Start
1