Query (optional)   in Class  

GrainGenes Sequence Report: M11075_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
M11075_1.cds
Peptide
MKTFLILALRAIVATTATIAVRVPVPQLQPQNPSQQQPQKQVPLVQQQQF
PGQQQPFPPQQPYPQQQPFPSQQPYMQLQPFPQPQLPYPQPQLPYPQPQP
FRPQQSYPQPQPQYSQPQQPISQQQQQQQQQQQQQQQILQQILQQQLIPC
RDVVLQQHSIAHGSSQVLQQSTYQLVQQFCCQQLWQIPEQSRCQAIHNVV
HAIILHQQQQQQQQQQQQQQQPLSQVCFQQSQQQYPSGQGSFQPSQQNPQ
AQGSVQPQQLPQFEEIRNLALETLPAMCNVYIPPYCTIAPVGIFGTN
Structure From Source
M11075
Source Exons
1894
Corresponding Protein
M11075_1.protseq
Remark
CDS note: pre-alpha-/beta-gliadin A-IV
DB_xref: GI:170724
Feature: CDS: protein_id = 'AAA34282.1';
Codon Start
1