Query (optional)   in Class  

GrainGenes Sequence Report: M11077_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
M11077_1.cds
Peptide
MKTFLVFALIAVVATSAIAQMETSCISGLERPWQQQPLPPQQSFSQQPPF
SQQQQQPLPQQPSFSQQQPPFSQQQPILSQQPPFSQQQQPVLPQQSPFSQ
QQQLVLPPQQQQQQLVQQQIPIVQPSVLQQLNPCKVFLQQQCSPVAMPQR
LARSQMWQQSSCHVMQQQCCQQLQQIPEQSRYEAIRAIIYSIILQEQQQG
FVQPQQQQPQQSGQGVSQSQQQSQQQLGQCSFQQPQQQLGQQPQQQQQQQ
VLQGTFLQPHQIAHLEAVTSIALRTLPTMCSVNVPLYSATTSVPFGVGTG
VGAY
Structure From Source
M11077
Source Exons
1915
Corresponding Protein
M11077_1.protseq
Remark
CDS note: pre-gamma-gliadin B-I
DB_xref: GI:170730
Feature: CDS: protein_id = 'AAA34285.1';
Codon Start
1