Query (optional)   in Class  

GrainGenes Sequence Report: M11335_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
M11335_1.cds
Peptide
PQQPFPLQPQQSFLWQSQQPFLQQPQQPSPQPQQVVQIISPATPTTIPSA
GKPTSAPFPQQQQQHQQLAQQQIPVVQPSILQQLNPCKVFLQQQCSPVAM
PQRLARSQMLQQSSCHVMQQQCCQQLPQIPQQSRYQAIRAIIYSIILQEQ
QQVQGSIQSQQQQPQQLGQCVSQPQQQSQQQLGQQPQQQQLAQGTFLQPH
QIAQLEVMTSIALRILPTMCSVNVPLYRTTTSVPFGVGTGVGAY
Structure From Source
M11335
Source Exons
1735
Corresponding Protein
M11335_1.protseq
Remark
CDS note: gamma gliadin B-III
DB_xref: GI:170734
Feature: CDS: protein_id = 'AAA34287.1';
Codon Start
1