Query (optional)   in Class  

GrainGenes Sequence Report: M11336_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
M11336_1.cds
Peptide
TITRTFPIPTISSNNNHHFRSNSNHHFHSNNNQFYRNNNSPGHNNPLNNN
NSPNNNSPSNHHNNSPNNNFQYHTHPSNHKNLPHTNNIQQQQPPFSQQQQ
PPFSQQQQPVLPQQSPFSQQQQLVLPPQQQQQQLVQQQIPIVQPSVLQQL
NPCKVFLQQQCSPVAMPQRLARSQMWQQSSCHVMQQQCCQQLQQIPEQSR
YEAIRAIIYSIILQEQQQGFVQPQQQQPQQSGQGVSQSQQQSQQQLGQCS
FQQPQQQLGQQPQQQQQQQVLQGTFLQPHQIAHLEAVTSIALRTLPTMCS
VNVPLYSATTSVPFGVGTGVGAY
Structure From Source
M11336
Source Exons
1973
Corresponding Protein
M11336_1.protseq
Remark
CDS note: gamma-gliadin
DB_xref: GI:170732
Feature: CDS: protein_id = 'AAA34286.1';
Codon Start
2