Query (optional)   in Class  

GrainGenes Sequence Report: M12277_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
M12277_1.cds
Peptide
MSGRDKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGL
IYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYG
FGG
Structure From Source
M12277
Source Exons
1312
Corresponding Protein
M12277_1.protseq
Remark
CDS note: histone H4
DB_xref: GI:170747
Feature: CDS: protein_id = 'AAA34292.1';
Codon Start
1