Query (optional)   in Class  

GrainGenes Sequence Report: M13713_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
M13713_1.cds
Peptide
MKTLLILTILAMAITIATANMQADPSGQVQWPQQQPFLQPHQPFSQQPQQ
IFPQPQQTFPHQPQQQFPQPQQPQQQFLQPRQPFPQQPQQPYPQQPQQPF
PQTQQPQQPFPQSKQPQQPFPQPQQPQQSFPQQQPSLIQQSLQQQLNPCK
NFLLQQCKPVSLVSSLWSIILPPSDCQVMRQQCCQQLAQIPQQLQCAAIH
SVVHSIIMQQEQQEQLQGVQILVPLSQQQQVGQGILVQGQGIIQPQQPAQ
LEVIRSLVLQTLPTMCNVYVPPYCSTIRAPFASIVASIGGQ
Structure From Source
M13713
Source Exons
1876
Corresponding Protein
M13713_1.protseq
Remark
CDS note: gamma-gliadin B precursor
DB_xref: GI:170708
Feature: CDS: protein_id = 'AAA34274.1';
Codon Start
1