Query (optional)   in Class  

GrainGenes Sequence Report: M15207_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
M15207_1.cds
Peptide
MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPS
GECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCN
VNVPYTISPDIDCSRIY
Structure From Source
M15207
Source Exons
1354
Corresponding Protein
M15207_1.protseq
Remark
CDS note: amylase/protease inhibitor
DB_xref: GI:167077
Feature: CDS: protein_id = 'AAA32970.1';
Codon Start
1