Query (optional)   in Class  

GrainGenes Sequence Report: M15208_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
M15208_1.cds
Peptide
MGKNGNLCCFSLLLLLLAGLASGHQVLFQGFNWESWKQSGGWYNMMMGKV
DDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGA
LHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPHMICRD
DTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAW
RLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQ
NLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKPPDVMG
WWPAKAVTFVDNHDTGSTQPMWPFPSDKVMQGYAYILTHPGTPCIFYDHF
FNWGFKDEIAALVAIRKRNGITATSALEILMHEGDAYVAEIDGKVVVKIG
TRYDVGAVIPAGFATSAHGKD
Structure From Source
M15208
Source Exons
187
188320
5741388
14851715
Corresponding Protein
M15208_1.protseq
Remark
CDS note: alpha-amylase
DB_xref: GI:167001
Feature: CDS: protein_id = 'AAA32935.1';
Codon Start
1