Query (optional)   in Class  

GrainGenes Sequence Report: U00966_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
U00966_1.cds
Peptide
MGSATVLEVILAIILPPVGVFLRYKLGVEFWICLLLTILGYIPGIIYAVY
VLVV
Structure From Source
U00966
Source Exons
1165
Corresponding Protein
U00966_1.protseq
Gene Product
salt-stress induced hydrophobic peptide
Remark
DB_xref: GI:551068
Feature: CDS: citation = [3]; protein_id = 'AAA21847.1';
Gene: ESI3
Codon Start
1