Query (optional)   in Class  

GrainGenes Sequence Report: U01228_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
U01228_1.cds
Peptide
MSAAEGAVVFSEEKEALVLKSWAIMKKDSANLGLRFFLKIFEIAPSARQM
FPFLRDSDVPLETNPKLKTHAVSVFVMTCEAAAQLRKAGKITVRETTLKR
LGGTHLKYGVADGHFEVTRFALLETIKEALPADMWGPEMRNAWGEAYDQL
VAAIKQEMKPAE
Structure From Source
U01228
Source Exons
1489
Corresponding Protein
U01228_1.protseq
Gene Product
haemoglobin apoprotein
Remark
CDS note: known to be functional in other species, no direct evidence for barley.
DB_xref: GI:508204
Feature: CDS: function = 'presumed oxygen binding'; protein_id = 'AAA19576.1';
Gene: hb
Codon Start
1