Query (optional)   in Class  

GrainGenes Sequence Report: X00043_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
X00043_1.cds
Peptide
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGL
IYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYG
FGG
Structure From Source
X00043
Source Exons
1312
Corresponding Protein
X00043_1.protseq
Remark
CDS note: histone H4
DB_xref: GI:21795
DB_xref: SWISS-PROT:P02308
Feature: CDS: protein_id = 'CAA24924.1';
Codon Start
1