Query (optional)   in Class  

GrainGenes Sequence Report: X00054_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
X00054_1.cds
Peptide
EKLGQGQQPRQWLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQ
SGQGQQGYDSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLAS
Q
Structure From Source
X00054
Source Exons
1306
Corresponding Protein
X00054_1.protseq
Remark
CDS note: high Mr-gluten polypeptide
DB_xref: GI:897811
DB_xref: SWISS-PROT:P02861
Feature: CDS: protein_id = 'CAA24933.1';
Codon Start
1