Query (optional)   in Class  

GrainGenes Sequence Report: X00055_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
X00055_1.cds
Peptide
LVSVEHQAARLKVAKAQQLAAQLPAMCRLEGGDALSASQ
Structure From Source
X00055
Source Exons
1120
Corresponding Protein
X00055_1.protseq
Remark
CDS note: high-Mr gluten polypeptide
DB_xref: GI:21793
DB_xref: SWISS-PROT:P02862
Feature: CDS: protein_id = 'CAA24934.1';
Codon Start
1