Query (optional)   in Class  

GrainGenes Sequence Report: X00234_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
X00234_1.cds
Peptide
AYLPPLSTEALLKQVDYLIRSKWVPCLEFSKVGFIFREHNASPGYYDGRY
WTMWKLPMFGCTDATQVINEVEEVKKEYPDAYVRIIGFDNMRQVQCVSFI
AFKPPGCEESGKA
Structure From Source
X00234
Source Exons
1342
Corresponding Protein
X00234_1.protseq
Remark
CDS note: small subunit
DB_xref: GI:21866
DB_xref: SWISS-PROT:P07398
Feature: CDS: protein_id = 'CAA25057.1';
Codon Start
1