Query (optional)   in Class  

GrainGenes Sequence Report: X00235_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
X00235_1.cds
Peptide
VAPFQGLKSTAGLPVSRRSNGASLGSVSNGGRIRCMQVWPIEGIKKFETL
SYLPPLSTEALLKQVDYLIRSKWVPCLEFSKVGFIFREHNASPVXXXXXX
XXXXXXXXXXXXXXXXXXXEVEEVKKEYPDAYVRIIGFDNMRQVQCVSFI
AFKPPGCEESGKA
Structure From Source
X00235
Source Exons
1493
Corresponding Protein
X00235_1.protseq
Gene Product
ribulosebisphosphate carboxylase
Remark
DB_xref: GI:755804
DB_xref: SPTREMBL:Q41582
Feature: CDS: protein_id = 'CAA25058.1';
Codon Start
2