Query (optional)   in Class  

GrainGenes Sequence Report: X00408_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
X00408_1.cds
Peptide
MRTNPTTSRPGVSTSEEKSTGRIDQIIGPVLDVTFPPGKLPYIYNALVVQ
SRDTADKQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSV
PVGGATLGRIFNVLGEPVDNLGPVDSSATFPIHRSAPAFIELDTKLSIFE
TGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFG
GVGERTREGNDLYMEMKESGVINEKNIEESKVALVYGQMNEPPGARMRVG
LTALTMAEYFRDVNKQDVLLFIDDIFRFVQAGSEVSALLGRMPSAVGYQP
TLSTEMGSLQERIASTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATT
VLSRGLASKGIYPAVDPLDSTSTMLQPRIVGNEHYETAQRVKETLQRYKE
LQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVA
LAETIRGFQLILSGELDGLPEQAFYLVGNIDEASTKAITLEEENKSQK
Structure From Source
X00408
Source Exons
11497
Corresponding Protein
X00408_1.protseq
Gene Product
ATPase, beta subunit
Remark
DB_xref: GI:11583
[ Show all 12 ]
Codon Start
1