Query (optional)   in Class  

GrainGenes Sequence Report: X00408_2.cds

[ Submit comment/correction ]

Sequence
X00408_2.cds
Peptide
MKLNLYVLTPKRIIWDCEVKEIILSTNSGQIGVLPNHAPINTAVDMGPLR
IRLLNDQWLTAVLWSGFARIVNNEIIILGNDAELGSDIDPEEAQKALEIA
EANLSKAEGTKDLVEAKLALRRARIRIEAVNWIPPSN
Structure From Source
X00408
Source Exons
1414
Corresponding Protein
X00408_2.protseq
Gene Product
ATPase, subunit E
Remark
DB_xref: GI:1334361
[ Show all 8 ]
Codon Start
1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.