Query (optional)   in Class  

GrainGenes Sequence Report: X00408_3.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
X00408_3.cds
Peptide
MFLLHEYDIFWTFLIIASLIPILAFSISGILAPVSEGPEKL
Structure From Source
X00408
Source Exons
1123
Corresponding Protein
X00408_3.protseq
Remark
CDS note: unnamed protein product; ORFA
[ Show all 7 ]
Codon Start
1