Query (optional)   in Class  

GrainGenes Sequence Report: X00538_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
X00538_1.cds
Peptide
MENRNTFSWVKEQITRSISVSIMIYVITRTSISNAYPIFAQQGYENPREA
TGRIVCANCHLASKPVDIEVPQAVLPDTVFEAVLRIPYDMQLKQVLANGK
KGGLNVGAVLILPEGFELAPPDRISPELKEKIGNLAFQSYRPDKKNILVI
GPVPGKKYSEIVFPILSPDPATKKDAHFLKYPIYVGGNRGRGQIYPDGSK
SNNTVYNATSTGIVRKILRKEKGGYEISIVDASDGRQVIDIIPPGPELLV
SEGESIKLDQPLTSNPNVGGFGQGDAEIVLQDPLRVQGLLFFFASVILAQ
VFLVLKKKQFEKVQLYEMNF
Structure From Source
X00538
Source Exons
1963
Corresponding Protein
X00538_1.protseq
Gene Product
cytochrome f
Remark
DB_xref: GI:758344
[ Show all 8 ]
Codon Start
1