Query (optional)   in Class  

GrainGenes Sequence Report: X00627_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
X00627_1.cds
Peptide
MKTFLILVLLAIVATTATTAVRFPVPQLQPQNPSQQLPQEQVPLVQQQQF
LGQQQPFPPQQPYPQPQPFPSQLPYLQLQPFPQPQLPYSQPQPFRPQQPY
PQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQILQQILQQQLIPCMDVV
LQQHNIAHGRSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAII
LHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQLP
QFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN
Structure From Source
X00627
Source Exons
1861
Corresponding Protein
X00627_1.protseq
Gene Product
gliadin
Remark
DB_xref: GI:21753
DB_xref: SWISS-PROT:P02863
Feature: CDS: protein_id = 'CAA25261.1';
Codon Start
1