Query (optional)   in Class  

GrainGenes Sequence Report: X00630_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
X00630_1.cds
Peptide
MRTNPTTSRPGVSTSEEKSTGRIDQIIGPVLDVTFPPG
Structure From Source
X00630
Source Exons
1113
Corresponding Protein
X00630_1.protseq
Remark
CDS note: unnamed protein product; ATPase beta-subunit
[ Show all 8 ]
Codon Start
1