Query (optional)   in Class  

GrainGenes Sequence Report: X00630_2.cds

[ Submit comment/correction ]

Sequence
X00630_2.cds
Peptide
MSPQTETKAGVGFQAGVKDYKLTYYTPEYETKDTDILAAFRVSPQPGVPP
EEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGEDSQWICY
VAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPTYSKTFQG
PPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRACYECLRGGLDFT
KDDENVNSQPFMRWRDRFVFCAEAIYKSQAETGEIKGHYLNATAGTCEEM
IKRAVFARELGVPIVMHDYLTGGFTANTTLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRMSGGDHIHSGTVVGKLEGEREMTLGFVDLLR
DDFIEKDRARGIFFTQDWVSMPGVIPVASGGIHVWHMPALTEIFGDDSVL
QFGGGTLGHPWGNAPGAAANRVALEA
Structure From Source
X00630
Source Exons
11279
Corresponding Protein
X00630_2.protseq
Remark
CDS note: unnamed protein product; rbc large subunit
[ Show all 9 ]
Codon Start
1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.