Query (optional)   in Class  

GrainGenes Sequence Report: X00937_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
X00937_1.cds
Peptide
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALR
EIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAY
LVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Structure From Source
X00937
Source Exons
1411
Corresponding Protein
X00937_1.protseq
Remark
CDS note: unnamed protein product; H3 histone
[ Show all 8 ]
Codon Start
1