Query (optional)   in Class  

GrainGenes Sequence Report: X01108_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
X01108_1.cds
Peptide
MILRSLSCRFLTIALCDAAEPWQLGSQDAATPMMQGIIDLHHDIFFFLIL
ILVFVSRMLVRALWHFNEQTNPIPQRIVHGTTIEIIRTIFPSVILLFIAI
PSFALLYSMDGVLVDPAITIKAIGHQWYRSYEYSDYNSSDEQSLTFDSYT
IPEDDPELGQSRLLEVDNRVVVPAKTHLRMIVTPADVPHSWAVPSSGVKC
DAVPGRSNLTSISVQREGVYYGQCSEIRGTNHAFTPIVVEAVTLKDYADW
VSNQLILQTN
Structure From Source
X01108
Source Exons
1390
16082000
Corresponding Protein
X01108_1.protseq
Gene Product
cytochrome oxidase II (COII)
Remark
DB_xref: GI:13691
DB_xref: SWISS-PROT:P00413
Feature: CDS: protein_id = 'CAA25581.1';
Gene: COII
Codon Start
1