Query (optional)   in Class  

GrainGenes Sequence Report: X01130_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
X01130_1.cds
Peptide
MKTFLILVLLAIVATTATTAVRFPVPQLQPQNPSQQQPQEQVPLVQQQQF
LGQQQPFPPQQPYPQPQPFPSQLPYLQLQPFPQPQLPYSQPQPFRPQQPY
PQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQILQQILQQQLIPCMDVV
LQQHNIAHGRSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAILKVVHAII
LHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQLP
QFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN
Structure From Source
X01130
Source Exons
1861
Corresponding Protein
X01130_1.protseq
Remark
CDS note: storage protein (aa 1-286)
DB_xref: GI:21755
DB_xref: SWISS-PROT:P02863
Feature: CDS: protein_id = 'CAA25593.1';
Codon Start
1