Query (optional)   in Class  

GrainGenes Sequence Report: X01777_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
X01777_1.cds
Peptide
QQPVSRQPQQIIPQQPQQPFPLQPQQPQPFPQQPIPQQPQPYPQQPQSFP
QQPFPSQQPFPQQPPFWQQQPVLSQQQPCTQDQTPLLQEQQDQMLVQVQI
PFVHPSILQQLNPCKVFLQQQCSPLAMSQRIARSQMLQQSSCHVLQQQCC
QQLPQIPEQLRHEAVRAIVYSIVLQEQSLQLVQGVSQPQQQSQQQQVGQC
SFQQPQPQQGQQQQVPQSVFLQPHQIAQLEATTSIALRTLPTMCSVNVPL
YRIVPLAIDTRVGV
Structure From Source
X01777
Source Exons
1795
Corresponding Protein
X01777_1.protseq
Remark
CDS note: B3-hordein fragment
DB_xref: GI:18914
DB_xref: SWISS-PROT:P06471
Feature: CDS: protein_id = 'CAA25912.1';
Codon Start
1