Query (optional)   in Class  

GrainGenes Sequence Report: X01778_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
X01778_1.cds
Peptide
PFPPQQPFPQQPVPQQPQPYPQQPQPFPQQPPFCQQKPFPQQPPFGLQQP
ILSQQQPCTPQQTPLPQGQLYQTLLQLQIQYVHPSILQQLNPCKVFLQQQ
CSPLPVPQRIARSQMLQQSSCHVLQQQCCQQLPQIPEQFRHEAIRAIVYS
IFLQEQPQQLVEGVSQPQQQLWPQQVGQCSFQQPQPQQVGQQQQVPQSAF
LQPHQIAQLEATTSIALRTLPMMCSVNVPLYRILRGVGPSVGV
Structure From Source
X01778
Source Exons
1733
Corresponding Protein
X01778_1.protseq
Remark
CDS note: B1-hordein fragment
DB_xref: GI:829269
DB_xref: SPTREMBL:Q40022
Feature: CDS: protein_id = 'CAA25913.1';
Codon Start
2