Query (optional)   in Class  

GrainGenes Sequence Report: X01779_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
X01779_1.cds
Peptide
QPQQSYPVQPQQPFPQPQPVPQQRPQQASPLQPQQPFPQGSEQIIPQQPF
PLQPQPFPQQPQQPLPQPQQPFRQQAELIIPQQPQQPLPLQPHQPYTQQT
IWSMV
Structure From Source
X01779
Source Exons
1318
Corresponding Protein
X01779_1.protseq
Remark
CDS note: C-hordein fragment
DB_xref: GI:18949
DB_xref: SWISS-PROT:P06472
Feature: CDS: protein_id = 'CAA25914.1';
Codon Start
1