Query (optional)   in Class  

GrainGenes Sequence Report: X02352_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
X02352_1.cds
Peptide
MTIRNQRFSLLKQPIYSTLNQHLIDYPTPSNLSYWWGFGSLAGICLVIQI
VTGVFLAMHHTPHVDLAFNSVEHIMRDVEGGWLLRYMHANGASMFLIVVH
LHIFRGLYHASYSSPREFVRCLGVVIFLLMIVTAFIGYVPPWGQMSFWGA
TVITSLASAIPVVGDTIVTWLWGGFSVDNATLNRFFSLHHLLPLILVGAS
LLHLAALHQYGSNNPLGVHSEMDKIASYPYFYVKDLVGRVASAIFFSIWI
FFAPNVLGHPDNYIPANPMPTPPHIVPEWYFLPIHAILRSIPDKAGGVAA
IAPVFISLLALPFFKEMYVRSSSFRPIHQGIFWLLLADCLLLGWIGCQPV
EAPFVTIGQIPSVFFFLFFAITPIPGRVGRGIPKYYTDETHRTGSFWP
Structure From Source
X02352
Source Exons
11197
Corresponding Protein
X02352_1.protseq
Remark
CDS note: unnamed protein product; apocytochrome b (aa 1-498)
[ Show all 8 ]
Codon Start
1