Query (optional)   in Class  

GrainGenes Sequence Report: X02538_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
X02538_1.cds
Peptide
MKTFLILALLAIVATTATTAVRVPVPQPQPQNPSQPQPQGQVPLVQQQQF
PGQQQQFPPQQPYPQPQPFPSQQPYLQLQPFPQPQPFPPQLPYPQPPPFS
PQQPYPQPQPQYPQPQQPISQQQAQQQQQQQQQQQQQQQQQQILQQILQQ
QLIPCRDVVLQQHNIAHARSQVLQQSTYQPLQQLCCQQLWQIPEQSRCQA
IHNVVHAIILHQQQRQQQPSSQVSLQQPQQQYPSGQGFFQPSQQNPQAQG
SVQPQQLPQFEEIRNLALQTLPRMCNVYIPPYCSTTIAPFGIFGTN
Structure From Source
X02538
Source Exons
1891
Corresponding Protein
X02538_1.protseq
Remark
CDS note: gliadin precursor
DB_xref: GI:21757
DB_xref: SWISS-PROT:P04726
Feature: CDS: protein_id = 'CAA26383.1';
Codon Start
1