Query (optional)   in Class  

GrainGenes Sequence Report: X02540_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
X02540_1.cds
Peptide
MKTFLILALVATTATTAVRVPVPQLQPKNPSQQQPQEQVPLVQQQQFPGQ
QQQFPPQQPYPQPQPFPSQQPYLQLQPFPQPQPFLPQLPYPQPQSFPPQQ
PYPQQRPMYLQPQQPISQQQAQQQQQQQQQQQQQQQQQILQQILQQQLIP
CRDVVLQQHNIAHASSQVLQQSTYQLLQQLCCQQLLQIPEQSRCQAIHNV
VHAIIMHQQEQQQQLQQQQQQQLQQQQQQQQQQQQPSSQVSFQQPQQQYP
SSQGSFQPSQQNPQAQGSVQPQQLPQFAEIRNLALQTLPAMCNVYIPPHC
STTIAPFGIFGTN
Structure From Source
X02540
Source Exons
1942
Corresponding Protein
X02540_1.protseq
Remark
CDS note: gliadin precursor
DB_xref: GI:21765
DB_xref: SPTREMBL:Q41546
Feature: CDS: protein_id = 'CAA26385.1';
Codon Start
1