Query (optional)   in Class  

GrainGenes Sequence Report: Y00704_1.cds

[ Submit comment/correction ]

Sequence
Y00704_1.cds
Peptide
MAALSSAAVSVPSFAAATPMRSSRSSRMVVRASLGKKAASAAVAMAAGAM
LLGGSAMAQDVLLGANGGVLVFEPNDFSVKAGETITFKNNAGYPHNVVFD
EDAVPSGVDVSKISQEEYLNAPGETFSVTLTVPGTYGFYCEPHAGAGMVG
KVTVN
Structure From Source
Y00704
Source Exons
1468
Corresponding Protein
Y00704_1.protseq
Gene Product
plastocyanin precursor
Remark
[ Hide all but 1 of 6 ]
DB_xref: GI:22705
DB_xref: GOA:P08248
DB_xref: UniProt/Swiss-Prot:P08248
DB_xref: SWISS-PROT:P08248
Feature: CDS: protein_id = 'CAA68696.1'
Feature: CDS: protein_id = 'CAA68696.1';
Codon Start
1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.