Query (optional)   in Class  

GrainGenes Sequence Report: Y09292_1.cds

[ Submit comment/correction ]

Sequence
Y09292_1.cds
Peptide
LIILTASRCLGREVREKLFDDVSALFHDLDNGMQPISVIFPYLPIPAHRR
RDQARTRLAEIFATIIKSRKASGQSEEDMLQCFIDSKYKNGRQTTESEVT
GLLIAALFAGQHTSSITSTWTGAYLLKFQQYFAEAVEEQKEVMKRHGDKI
DHDILAEMDVLYRCIKEALRLHPPLIMLLRQSHSDFSVTTREGKEFDIPK
GHIVATSPAFANRLPHIFKNPDSYDPDRFAAGREEDKVAGAFSYISFGGG
RHGCLGEPFAYLQIKAIWTHLLRNFEFELVSPFPENDWNAMVVGIKGEVM
VSYKRRKLVVDN
Structure From Source
Y09292
Source Exons
1939
Corresponding Protein
Y09292_1.protseq
Gene Product
obtusifoliol 14-alpha-demethylase
Remark
[ Hide all but 1 of 7 ]
DB_xref: GI:1707855
DB_xref: GOA:P93596
DB_xref: UniProt/Swiss-Prot:P93596
DB_xref: SWISS-PROT:P93596
Feature: CDS: protein_id = 'CAA70476.1'
Feature: CDS: protein_id = 'CAA70476.1';
Gene: CYP51
Codon Start
1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.