Query (optional)   in Class  

GrainGenes Sequence Report: Y00123_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
Y00123_1.cds
Peptide
MASGQQERSQLDRKAREGETVVPGGTGGKSLEAQENLAEGRSRGGQTRRE
QMGEEGYSQMGRKGGLSTNDESGGDRAAREGIDIDESKFKTKS
Structure From Source
Y00123
Source Exons
1282
Corresponding Protein
Y00123_1.protseq
Remark
CDS note: Em protein (AA 1-93)
DB_xref: GI:21733
DB_xref: SWISS-PROT:P04568
Feature: CDS: protein_id = 'CAA68322.1';
Codon Start
1