Query (optional)   in Class  

GrainGenes Sequence Report: Y00417_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
Y00417_1.cds
Peptide
MTNMVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQIL
GGNHQLYNVLITAHAFLMIFFMVMPAMIGGFGNWFVPILIGAPDMAFPRL
NNISFWLLPPSLLLLLSSALVEVGSGTGWTVYPPLSGITSHSGGAVDLAI
FSLHLSGISSILGSINFITTIFNMRGPGMTMHRLPLFVWSVLVTAFLLLL
SLPVLAGAITMLLTDRNFNTTFFDPAGGGDPILYQHLFWFFGHPEVYILI
LPGFGIISHIVSTFSRKPVFGYLGMVYAMISIGVLGFLVWAHHMFTVGLD
VDTRAYFTAATMIIAVPTGIKIFSWIATMWGGSIQYKTPMLFAVGFIFLF
TIGGLTGIVLANSGLDIALHDTYYVVAHFHYVLSMGAVFALFAGFYYWVG
KIFGRTYPETLGQIHFWITFFGVNLTFFPMHFLGLSGMPRRIPDYPDAYA
GWNALSSFGSYISVVGIRRFFVVVAITSSSGKNQKCAESPWAVEQNPTTL
EWLVQSPPAFHTFGELPAVKETKS
Structure From Source
Y00417
Source Exons
11575
Corresponding Protein
Y00417_1.protseq
Remark
CDS note: unnamed protein product; cytochrome oxidase subunit I (AA 1-524)
[ Show all 9 ]
Codon Start
1