Query (optional)   in Class  

GrainGenes Sequence Report: Y00520_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
Y00520_1.cds
Peptide
MSYISGARSLPDEQVRIASTKMDGIGPKKAIQLRYRLGISGNIKMNELTK
YQIDQIEQMIAQDHVVHWELKRGERADIERLISISRYRGIRHQDGSPLRG
QRTHTNARTARKQIRK
Structure From Source
Y00520
Source Exons
1351
Corresponding Protein
Y00520_1.protseq
Remark
CDS note: ribosomal protein S13 (AA 1 - 116)
DB_xref: GI:13716
DB_xref: SWISS-PROT:P07924
Feature: CDS: protein_id = 'CAA68574.1';
Codon Start
1