Query (optional)   in Class  

GrainGenes Sequence Report: Y00704_1.cds

[ Submit comment/correction ]

Sequence
Y00704_1.cds
Peptide
MAALSSAAVSVPSFAAATPMRSSRSSRMVVRASLGKKAASAAVAMAAGAM
LLGGSAMAQDVLLGANGGVLVFEPNDFSVKAGETITFKNNAGYPHNVVFD
EDAVPSGVDVSKISQEEYLNAPGETFSVTLTVPGTYGFYCEPHAGAGMVG
KVTVN
Structure From Source
Y00704
Source Exons
1468
Corresponding Protein
Y00704_1.protseq
Gene Product
plastocyanin precursor
Remark
DB_xref: GI:22705
[ Show all 6 ]
Codon Start
1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.